Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein Putative polyketide synthase SCO1206 [110762] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [110763] (1 PDB entry) Uniprot Q9FCA7 |
Domain d1u0mb1: 1u0m B:2-201 [107559] complexed with 15p, gol |
PDB Entry: 1u0m (more details), 2.22 Å
SCOPe Domain Sequences for d1u0mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0mb1 c.95.1.2 (B:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} atlcrpsvsvpehvitmeetlelarrrhtdhpqlplalrlientgvrtrhivqpiedtle hpgfedrnkvyereaksrvpaviqralddaellatdidviiyvsctgfmmpsltawline mgfdsttrqipiaqlgcaaggaainrahdfctaypeanalivacefcslcyqptdlgvgs llcnglfgdgiaaavvrgrg
Timeline for d1u0mb1: