SCOPe 2.08: Domain d1u0ma2: 1u0m A:202-349

Lineage for d1u0ma2 (1u0m A:202-349)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein Putative polyketide synthase SCO1206, C-terminal domain [419037] (1 species)
7. Species Streptomyces coelicolor [TaxId:1902] [419521] (1 PDB entry)
   Uniprot Q9FCA7

8. Domain d1u0ma2: 1u0m A:202-349 [107558]
   Other proteins in same PDB: d1u0ma1, d1u0mb1
   complexed with 15p, gol

Details for d1u0ma2

PDB Entry: 1u0m, 2.22 Å

PDB Description: Crystal Structure of 1,3,6,8-Tetrahydroxynaphthalene Synthase (THNS) from Streptomyces coelicolor A3(2): a Bacterial Type III Polyketide Synthase (PKS) Provides Insights into Enzymatic Control of Reactive Polyketide Intermediates

PDB Compounds: (A:) putative polyketide synthase

SCOPe Domain Sequences for d1u0ma2:

Sequence; same for both SEQRES and ATOM records:

>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206, C-terminal domain {Streptomyces coelicolor [TaxId: 1902]}
gtgvrlerngsylipktedwimydvkatgfhflldkrvpatmeplapalkelagehgwda
sdldfyivhaggprilddlstflevdphafrfsratlteygniasavvldalrrlfdegg
veegargllagfgpgitaemslgcwqta

Timeline for d1u0ma2:

• d1u0ma2 first appeared in SCOP 1.69
  
• d1u0ma2 appears in SCOPe 2.07