Lineage for d1u0ma1 (1u0m A:2-201)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495506Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins)
  6. 495613Protein Putative polyketide synthase SCO1206 [110762] (1 species)
  7. 495614Species Streptomyces coelicolor [TaxId:1902] [110763] (1 PDB entry)
  8. 495615Domain d1u0ma1: 1u0m A:2-201 [107557]

Details for d1u0ma1

PDB Entry: 1u0m (more details), 2.22 Å

PDB Description: Crystal Structure of 1,3,6,8-Tetrahydroxynaphthalene Synthase (THNS) from Streptomyces coelicolor A3(2): a Bacterial Type III Polyketide Synthase (PKS) Provides Insights into Enzymatic Control of Reactive Polyketide Intermediates

SCOP Domain Sequences for d1u0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor}
atlcrpsvsvpehvitmeetlelarrrhtdhpqlplalrlientgvrtrhivqpiedtle
hpgfedrnkvyereaksrvpaviqralddaellatdidviiyvsctgfmmpsltawline
mgfdsttrqipiaqlgcaaggaainrahdfctaypeanalivacefcslcyqptdlgvgs
llcnglfgdgiaaavvrgrg

SCOP Domain Coordinates for d1u0ma1:

Click to download the PDB-style file with coordinates for d1u0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1u0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0ma2