Lineage for d1u0lc2 (1u0l C:669-893)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846435Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species)
    circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain
  7. 1846438Species Thermotoga maritima [TaxId:2336] [110543] (1 PDB entry)
    Uniprot Q9X242 # TM1717
  8. 1846441Domain d1u0lc2: 1u0l C:669-893 [107556]
    Other proteins in same PDB: d1u0la1, d1u0lb1, d1u0lc1
    complexed with gdp, zn

Details for d1u0lc2

PDB Entry: 1u0l (more details), 2.8 Å

PDB Description: Crystal structure of YjeQ from Thermotoga maritima
PDB Compounds: (C:) Probable GTPase engC

SCOPe Domain Sequences for d1u0lc2:

Sequence, based on SEQRES records: (download)

>d1u0lc2 c.37.1.8 (C:669-893) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr
kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk
lrvsevseklqrgrhttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdk
qcffsdcnhvdepecgvkeavengeiaesryenyvkmfyellgrr

Sequence, based on observed residues (ATOM records): (download)

>d1u0lc2 c.37.1.8 (C:669-893) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr
kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk
lrttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdcnhvdep
ecgvkeavengeiaesryenyvkmfyellgrr

SCOPe Domain Coordinates for d1u0lc2:

Click to download the PDB-style file with coordinates for d1u0lc2.
(The format of our PDB-style files is described here.)

Timeline for d1u0lc2: