SCOPe 2.08: Domain d1u0lb2: 1u0l B:369-593

Lineage for d1u0lb2 (1u0l B:369-593)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species)
   circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain

7. Species Thermotoga maritima [TaxId:2336] [110543] (1 PDB entry)
   Uniprot Q9X242 # TM1717

8. Domain d1u0lb2: 1u0l B:369-593 [107554]
   Other proteins in same PDB: d1u0la1, d1u0lb1, d1u0lc1
   complexed with gdp, zn
   has additional subdomain(s) that are not in the common domain

Details for d1u0lb2

PDB Entry: 1u0l, 2.8 Å

PDB Description: Crystal structure of YjeQ from Thermotoga maritima

PDB Compounds: (B:) Probable GTPase engC

SCOPe Domain Sequences for d1u0lb2:

Sequence, based on SEQRES records:

>d1u0lb2 c.37.1.8 (B:369-593) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr
kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk
lrvsevseklqrgrhttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdk
qcffsdcnhvdepecgvkeavengeiaesryenyvkmfyellgrr

Sequence, based on observed residues (ATOM records):

>d1u0lb2 c.37.1.8 (B:369-593) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr
kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk
lrttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdcnhvdep
ecgvkeavengeiaesryenyvkmfyellgrr

Timeline for d1u0lb2:

• d1u0lb2 first appeared in SCOP 1.69
  
• d1u0lb2 appears in SCOPe 2.07