Lineage for d1u0lb1 (1u0l B:303-368)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789280Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species)
  7. 1789283Species Thermotoga maritima [TaxId:2336] [110201] (1 PDB entry)
    Uniprot Q9X242 # TM1717
  8. 1789285Domain d1u0lb1: 1u0l B:303-368 [107553]
    Other proteins in same PDB: d1u0la2, d1u0lb2, d1u0lc2
    complexed with gdp, zn

Details for d1u0lb1

PDB Entry: 1u0l (more details), 2.8 Å

PDB Description: Crystal structure of YjeQ from Thermotoga maritima
PDB Compounds: (B:) Probable GTPase engC

SCOPe Domain Sequences for d1u0lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0lb1 b.40.4.5 (B:303-368) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvie
nvlhrk

SCOPe Domain Coordinates for d1u0lb1:

Click to download the PDB-style file with coordinates for d1u0lb1.
(The format of our PDB-style files is described here.)

Timeline for d1u0lb1: