SCOPe 2.05: Domain d1u0lb1: 1u0l B:303-368

Lineage for d1u0lb1 (1u0l B:303-368)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [110201] (1 PDB entry)
   Uniprot Q9X242 # TM1717

8. Domain d1u0lb1: 1u0l B:303-368 [107553]
   Other proteins in same PDB: d1u0la2, d1u0lb2, d1u0lc2
   complexed with gdp, zn

Details for d1u0lb1

PDB Entry: 1u0l, 2.8 Å

PDB Description: Crystal structure of YjeQ from Thermotoga maritima

PDB Compounds: (B:) Probable GTPase engC

SCOPe Domain Sequences for d1u0lb1:

Sequence; same for both SEQRES and ATOM records:

>d1u0lb1 b.40.4.5 (B:303-368) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvie
nvlhrk

Timeline for d1u0lb1:

• d1u0lb1 first appeared in SCOP 1.69
  
• d1u0lb1 appears in SCOPe 2.04
  
• d1u0lb1 appears in SCOPe 2.06
  
• d1u0lb1 appears in the current release, SCOPe 2.08