Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species) circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain |
Species Thermotoga maritima [TaxId:2336] [110543] (1 PDB entry) Uniprot Q9X242 # TM1717 |
Domain d1u0la2: 1u0l A:69-293 [107552] Other proteins in same PDB: d1u0la1, d1u0lb1, d1u0lc1 complexed with gdp, zn |
PDB Entry: 1u0l (more details), 2.8 Å
SCOPe Domain Sequences for d1u0la2:
Sequence, based on SEQRES records: (download)
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk lrvsevseklqrgrhttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdk qcffsdcnhvdepecgvkeavengeiaesryenyvkmfyellgrr
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk lrttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdcnhvdep ecgvkeavengeiaesryenyvkmfyellgrr
Timeline for d1u0la2:
View in 3D Domains from other chains: (mouse over for more information) d1u0lb1, d1u0lb2, d1u0lc1, d1u0lc2 |