| Class b: All beta proteins [48724] (176 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
| Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species) |
| Species Thermotoga maritima [TaxId:2336] [110201] (1 PDB entry) Uniprot Q9X242 # TM1717 |
| Domain d1u0la1: 1u0l A:3-68 [107551] Other proteins in same PDB: d1u0la2, d1u0lb2, d1u0lc2 complexed with gdp, zn |
PDB Entry: 1u0l (more details), 2.8 Å
SCOPe Domain Sequences for d1u0la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0la1 b.40.4.5 (A:3-68) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvie
nvlhrk
Timeline for d1u0la1:
View in 3DDomains from other chains: (mouse over for more information) d1u0lb1, d1u0lb2, d1u0lc1, d1u0lc2 |