SCOP 1.71: Domain d1u0kb2: 1u0k B:131-283

Lineage for d1u0kb2 (1u0k B:131-283)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam 02567

6. Protein Hypothetical protein PA4716 [110861] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110862] (1 PDB entry)

8. Domain d1u0kb2: 1u0k B:131-283 [107550]
   Structural genomics target

Details for d1u0kb2

PDB Entry: 1u0k, 1.5 Å

PDB Description: the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa

SCOP Domain Sequences for d1u0kb2:

Sequence; same for both SEQRES and ATOM records:

>d1u0kb2 d.21.1.2 (B:131-283) Hypothetical protein PA4716 {Pseudomonas aeruginosa}
pdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrarqvndlqealdkl
gaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaargepfvlhqgrfl
erpsrldvqvatdgsvrvgghvqllaraellts

Timeline for d1u0kb2:

• d1u0kb2 first appeared in SCOP 1.69
  
• d1u0kb2 appears in SCOP 1.73
  
• d1u0kb2 appears in the current release, SCOPe 2.08