Lineage for d1u0kb2 (1u0k B:131-283)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939601Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam PF02567
  6. 2939606Protein Hypothetical protein PA4716 [110861] (1 species)
  7. 2939607Species Pseudomonas aeruginosa [TaxId:287] [110862] (1 PDB entry)
    Uniprot Q9HV82
  8. 2939611Domain d1u0kb2: 1u0k B:131-283 [107550]
    Structural genomics target

Details for d1u0kb2

PDB Entry: 1u0k (more details), 1.5 Å

PDB Description: the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa
PDB Compounds: (B:) gene product PA4716

SCOPe Domain Sequences for d1u0kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0kb2 d.21.1.2 (B:131-283) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]}
pdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrarqvndlqealdkl
gaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaargepfvlhqgrfl
erpsrldvqvatdgsvrvgghvqllaraellts

SCOPe Domain Coordinates for d1u0kb2:

Click to download the PDB-style file with coordinates for d1u0kb2.
(The format of our PDB-style files is described here.)

Timeline for d1u0kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0kb1