SCOPe 2.04: Domain d1u0kb1: 1u0k B:2-130

Lineage for d1u0kb1 (1u0k B:2-130)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Hypothetical protein PA4716 [110861] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110862] (1 PDB entry)
   Uniprot Q9HV82

8. Domain d1u0kb1: 1u0k B:2-130 [107549]
   Structural genomics target

Details for d1u0kb1

PDB Entry: 1u0k, 1.5 Å

PDB Description: the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa

PDB Compounds: (B:) gene product PA4716

SCOPe Domain Sequences for d1u0kb1:

Sequence; same for both SEQRES and ATOM records:

>d1u0kb1 d.21.1.2 (B:2-130) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]}
srrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafra
riftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaemd
qgraefgat

Timeline for d1u0kb1:

• d1u0kb1 first appeared in SCOP 1.69
  
• d1u0kb1 appears in SCOPe 2.03
  
• d1u0kb1 appears in SCOPe 2.05
  
• d1u0kb1 appears in the current release, SCOPe 2.08