![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
![]() | Protein Hypothetical protein PA4716 [110861] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110862] (1 PDB entry) Uniprot Q9HV82 |
![]() | Domain d1u0kb1: 1u0k B:2-130 [107549] Structural genomics target |
PDB Entry: 1u0k (more details), 1.5 Å
SCOPe Domain Sequences for d1u0kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0kb1 d.21.1.2 (B:2-130) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]} srrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafra riftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaemd qgraefgat
Timeline for d1u0kb1: