Lineage for d1u0ka1 (1u0k A:2-130)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600808Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 600809Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 600817Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam 02567
  6. 600822Protein Hypothetical protein PA4716 [110861] (1 species)
  7. 600823Species Pseudomonas aeruginosa [TaxId:287] [110862] (1 PDB entry)
  8. 600824Domain d1u0ka1: 1u0k A:2-130 [107547]

Details for d1u0ka1

PDB Entry: 1u0k (more details), 1.5 Å

PDB Description: the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa

SCOP Domain Sequences for d1u0ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ka1 d.21.1.2 (A:2-130) Hypothetical protein PA4716 {Pseudomonas aeruginosa}
srrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafra
riftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaemd
qgraefgat

SCOP Domain Coordinates for d1u0ka1:

Click to download the PDB-style file with coordinates for d1u0ka1.
(The format of our PDB-style files is described here.)

Timeline for d1u0ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0ka2