Lineage for d1u0ja1 (1u0j A:225-490)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871302Protein Rep 40 protein helicase domain [110564] (1 species)
  7. 2871303Species Adeno-associated virus 2, AAV2 [TaxId:10804] [110565] (2 PDB entries)
    Uniprot P03132 225-490
  8. 2871307Domain d1u0ja1: 1u0j A:225-490 [107546]
    Other proteins in same PDB: d1u0ja2
    complexed with adp
    has additional subdomain(s) that are not in the common domain

Details for d1u0ja1

PDB Entry: 1u0j (more details), 2.1 Å

PDB Description: crystal structure of aav2 rep40-adp complex
PDB Compounds: (A:) DNA replication protein

SCOPe Domain Sequences for d1u0ja1:

Sequence, based on SEQRES records: (download)

>d1u0ja1 c.37.1.20 (A:225-490) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}
melvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdyl
vgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktnia
eaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvdqk
ckssaqidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvtkq
evkdffrwakdhvvevehefyvkkgg

Sequence, based on observed residues (ATOM records): (download)

>d1u0ja1 c.37.1.20 (A:225-490) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}
melvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdyl
vgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktnia
eaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvsaq
idptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvtkqevkdff
rwakdhvvevehefyvkkgg

SCOPe Domain Coordinates for d1u0ja1:

Click to download the PDB-style file with coordinates for d1u0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1u0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0ja2