Lineage for d1u08a_ (1u08 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490721Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 490722Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 490723Family c.67.1.1: AAT-like [53384] (10 proteins)
  6. 490975Protein Putative methionine aminotransferase YdbL [110679] (1 species)
  7. 490976Species Escherichia coli [TaxId:562] [110680] (1 PDB entry)
  8. 490977Domain d1u08a_: 1u08 A: [107543]

Details for d1u08a_

PDB Entry: 1u08 (more details), 2.35 Å

PDB Description: Crystal Structure and Reactivity of YbdL from Escherichia coli Identify a Methionine Aminotransferase Function.

SCOP Domain Sequences for d1u08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli}
plipqsklpqlgttiftqmsalaqqhqainlsqgfpdfdgprylqerlahhvaqganqya
pmtgvqalreaiaqkterlygyqpdadsditvtagatealyaaitalvrngdevicfdps
ydsyapaialsggivkrmalqpphfrvdwqefaallsertrlvilntphnpsatvwqqad
faalwqaiagheifvisdevyehinfsqqghasvlahpqlreravavssfgktyhmtgwk
vgycvapapisaeirkvhqyltfsvntpaqlaladmlraepehylalpdfyrqkrdilvn
alnesrleilpcegtyfllvdysavstlddvefcqwltqehgvaaiplsvfcadpfphkl
irlcfakkestllaaaerlrql

SCOP Domain Coordinates for d1u08a_:

Click to download the PDB-style file with coordinates for d1u08a_.
(The format of our PDB-style files is described here.)

Timeline for d1u08a_: