SCOPe 2.08: Domain d1u05b_: 1u05 B:

Lineage for d1u05b_ (1u05 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets

4. Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families)

5. Family d.194.1.2: YfiH-like [111238] (5 proteins)
   Pfam PF02578; COG1496

6. Protein Hypothetical protein yfiH [111243] (3 species)

7. Species Shigella flexneri [TaxId:623] [111245] (2 PDB entries)
   Uniprot Q83K13

8. Domain d1u05b_: 1u05 B: [107542]
   Structural genomics target
   complexed with zn

Details for d1u05b_

PDB Entry: 1u05, 2.5 Å

PDB Description: crystal structure of protein yfih from shigella flexneri, pfam duf152

PDB Compounds: (B:) orf, conserved hypothetical protein

SCOPe Domain Sequences for d1u05b_:

Sequence; same for both SEQRES and ATOM records:

>d1u05b_ d.194.1.2 (B:) Hypothetical protein yfiH {Shigella flexneri [TaxId: 623]}
msklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnl
pskpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtev
aavhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakas
aafiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfi
wli

Timeline for d1u05b_:

• d1u05b_ first appeared in SCOP 1.69
  
• d1u05b_ appears in SCOPe 2.07