Lineage for d1u04a2 (1u04 A:324-770)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702473Family c.55.3.10: PIWI domain [110640] (3 proteins)
    Pfam PF02171
  6. 702482Protein Argonaute homologue PF0537 [110641] (1 species)
    includes the middle domain
  7. 702483Species Pyrococcus furiosus [TaxId:2261] [110642] (3 PDB entries)
  8. 702484Domain d1u04a2: 1u04 A:324-770 [107540]
    Other proteins in same PDB: d1u04a1
    mutant

Details for d1u04a2

PDB Entry: 1u04 (more details), 2.25 Å

PDB Description: Crystal structure of full length Argonaute from Pyrococcus furiosus
PDB Compounds: (A:) hypothetical protein PF0537

SCOP Domain Sequences for d1u04a2:

Sequence, based on SEQRES records: (download)

>d1u04a2 c.55.3.10 (A:324-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
iaqelenkirvrddkgnsvpisqlnvqksqlllwtnysrkypvilpyevpekfrkireip
mfiildsglladiqnfatnefrelvksmyyslakkynslakkarstneiglpfldfrgke
kvitedlnsdkgiievveqvssfmkgkelglafiaarnklssekfeeikrrlfnlnvisq
vvnedtlknkrdkydrnrldlfvrhnllfqvlsklgvkyyvldyrfnydyiigidvapmk
rsegyiggsavmfdsqgyirkivpikigeqrgesvdmneffkemvdkfkefnikldnkki
lllrdgritnneeeglkyisemfdievvtmdviknhpvrafanmkmyfnlggaiyliphk
lkqakgtpipiklakkriikngkvekqsitrqdvldifiltrlnygsisadmrlpapvhy
ahkfanairnewkikeeflaegflyfv

Sequence, based on observed residues (ATOM records): (download)

>d1u04a2 c.55.3.10 (A:324-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
iaqelenkirvrddkgnsvpisqllwtnysrkypvilpyevpekfrkireipmfiildsg
lladiqnfatnefrelvksmyyekvitedlnsdkgiievveqvssfmkgkelglafiaar
nklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsklgv
kyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvdm
neffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknhp
vrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvldi
filtrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv

SCOP Domain Coordinates for d1u04a2:

Click to download the PDB-style file with coordinates for d1u04a2.
(The format of our PDB-style files is described here.)

Timeline for d1u04a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u04a1