Lineage for d1u02a_ (1u02 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594610Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 594611Superfamily c.108.1: HAD-like [56784] (18 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 594825Family c.108.1.15: Trehalose-phosphatase [110506] (1 protein)
    Pfam 02358; contains an insert alpha+beta subdomain; similar overall fold to the Cof family
  6. 594826Protein Trehalose-6-phosphate phosphatase related protein [110507] (1 species)
  7. 594827Species Archaeon Thermoplasma acidophilum [TaxId:2303] [110508] (1 PDB entry)
  8. 594828Domain d1u02a_: 1u02 A: [107538]
    Structural genomics target
    complexed with gol, mg, na

Details for d1u02a_

PDB Entry: 1u02 (more details), 1.92 Å

PDB Description: crystal structure of trehalose-6-phosphate phosphatase related protein

SCOP Domain Sequences for d1u02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum}
slifldydgtlvpiimnpeesyadagllslisdlkerfdtyivtgrspeeisrflpldin
micyhgacskingqivynngsdrflgvfdriyedtrswvsdfpglriyrknlavlyhlgl
mgadmkpklrsrieeiarifgvetyygkmiielrvpgvnkgsairsvrgerpaiiagdda
tdeaafeanddaltikvgegethakfhvadyiemrkilkfiemlgvqkk

SCOP Domain Coordinates for d1u02a_:

Click to download the PDB-style file with coordinates for d1u02a_.
(The format of our PDB-style files is described here.)

Timeline for d1u02a_: