Lineage for d1u02a1 (1u02 A:4-230)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920123Family c.108.1.15: Trehalose-phosphatase [110506] (1 protein)
    Pfam PF02358; contains an insert alpha+beta subdomain; similar overall fold to the Cof family
  6. 2920124Protein Trehalose-6-phosphate phosphatase related protein [110507] (1 species)
  7. 2920125Species Thermoplasma acidophilum [TaxId:2303] [110508] (1 PDB entry)
    Uniprot Q9HIW7
  8. 2920126Domain d1u02a1: 1u02 A:4-230 [107538]
    Other proteins in same PDB: d1u02a2
    Structural genomics target
    complexed with gol, mg, na

Details for d1u02a1

PDB Entry: 1u02 (more details), 1.92 Å

PDB Description: crystal structure of trehalose-6-phosphate phosphatase related protein
PDB Compounds: (A:) trehalose-6-phosphate phosphatase related protein

SCOPe Domain Sequences for d1u02a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u02a1 c.108.1.15 (A:4-230) Trehalose-6-phosphate phosphatase related protein {Thermoplasma acidophilum [TaxId: 2303]}
ifldydgtlvpiimnpeesyadagllslisdlkerfdtyivtgrspeeisrflpldinmi
cyhgacskingqivynngsdrflgvfdriyedtrswvsdfpglriyrknlavlyhlglmg
admkpklrsrieeiarifgvetyygkmiielrvpgvnkgsairsvrgerpaiiagddatd
eaafeanddaltikvgegethakfhvadyiemrkilkfiemlgvqkk

SCOPe Domain Coordinates for d1u02a1:

Click to download the PDB-style file with coordinates for d1u02a1.
(The format of our PDB-style files is described here.)

Timeline for d1u02a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u02a2