Lineage for d1tzyb_ (1tzy B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. Protein Histone H2B [47119] (6 species)
  7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
    Uniprot P02279
  8. Domain d1tzyb_: 1tzy B: [107531]
    Other proteins in same PDB: d1tzya_, d1tzyc_, d1tzyd_, d1tzye_, d1tzyg_, d1tzyh_
    complexed with cl, po4

Details for d1tzyb_

PDB Entry: 1tzy (more details), 1.9 Å

PDB Description: Crystal Structure of the Core-Histone Octamer to 1.90 Angstrom Resolution
PDB Compounds: (B:) histone h2b

SCOPe Domain Sequences for d1tzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytss

SCOPe Domain Coordinates for d1tzyb_ are not available.

Timeline for d1tzyb_:

Domains from other chains:
(mouse over for more information)
d1tzya_, d1tzyc_, d1tzyd_, d1tzye_, d1tzyf_, d1tzyg_, d1tzyh_