SCOP 1.69: Domain d1tzxb_: 1tzx B:

Lineage for d1tzxb_ (1tzx B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (3 families)

5. Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)

6. Protein Antitermination factor NusB [48015] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [109929] (5 PDB entries)

8. Domain d1tzxb_: 1tzx B: [107529]

Details for d1tzxb_

PDB Entry: 1tzx, 1.72 Å

PDB Description: T. maritima NusB, P3221

SCOP Domain Sequences for d1tzxb_:

Sequence; same for both SEQRES and ATOM records:

>d1tzxb_ a.79.1.1 (B:) Antitermination factor NusB {Thermotoga maritima}
ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
fvngildriakehapkekfel

Timeline for d1tzxb_:

• d1tzxb_ is new in SCOP 1.69
  
• d1tzxb_ appears in SCOP 1.71
  
• d1tzxb_ appears in the current release, SCOPe 2.08