Lineage for d1tzxa_ (1tzx A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445548Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 445549Superfamily a.79.1: NusB-like [48013] (3 families) (S)
  5. 445550Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)
  6. 445551Protein Antitermination factor NusB [48015] (3 species)
  7. 445557Species Thermotoga maritima [TaxId:243274] [109929] (5 PDB entries)
  8. 445562Domain d1tzxa_: 1tzx A: [107528]

Details for d1tzxa_

PDB Entry: 1tzx (more details), 1.72 Å

PDB Description: T. maritima NusB, P3221

SCOP Domain Sequences for d1tzxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzxa_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima}
ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
fvngildriakehapkekfel

SCOP Domain Coordinates for d1tzxa_:

Click to download the PDB-style file with coordinates for d1tzxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tzxa_: