SCOPe 2.08: Domain d1tzxa_: 1tzx A:

Lineage for d1tzxa_ (1tzx A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (4 families)

5. Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
   automatically mapped to Pfam PF01029

6. Protein Antitermination factor NusB [48015] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [109929] (5 PDB entries)
   Uniprot Q9X286

8. Domain d1tzxa_: 1tzx A: [107528]
   complexed with cit

Details for d1tzxa_

PDB Entry: 1tzx, 1.72 Å

PDB Description: T. maritima NusB, P3221

PDB Compounds: (A:) N utilization substance protein B homolog

SCOPe Domain Sequences for d1tzxa_:

Sequence; same for both SEQRES and ATOM records:

>d1tzxa_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]}
ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
fvngildriakehapkekfel

Timeline for d1tzxa_:

• d1tzxa_ first appeared in SCOP 1.69
  
• d1tzxa_ appears in SCOPe 2.07