Lineage for d1tzva_ (1tzv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719091Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2719092Superfamily a.79.1: NusB-like [48013] (4 families) (S)
  5. 2719093Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
    automatically mapped to Pfam PF01029
  6. 2719094Protein Antitermination factor NusB [48015] (3 species)
  7. 2719101Species Thermotoga maritima [TaxId:2336] [109929] (5 PDB entries)
    Uniprot Q9X286
  8. 2719102Domain d1tzva_: 1tzv A: [107526]

Details for d1tzva_

PDB Entry: 1tzv (more details), 1.35 Å

PDB Description: T. maritima NusB, P3121, Form 1
PDB Compounds: (A:) N utilization substance protein B homolog

SCOPe Domain Sequences for d1tzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzva_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]}
mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm
iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg
kfvngildriakehapkekfe

SCOPe Domain Coordinates for d1tzva_:

Click to download the PDB-style file with coordinates for d1tzva_.
(The format of our PDB-style files is described here.)

Timeline for d1tzva_: