Lineage for d1tztb_ (1tzt B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540700Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 540701Superfamily a.79.1: NusB-like [48013] (3 families) (S)
  5. 540702Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)
  6. 540703Protein Antitermination factor NusB [48015] (3 species)
  7. 540709Species Thermotoga maritima [TaxId:243274] [109929] (5 PDB entries)
  8. 540713Domain d1tztb_: 1tzt B: [107524]
    complexed with so4

Details for d1tztb_

PDB Entry: 1tzt (more details), 1.55 Å

PDB Description: T. maritima NusB, P21

SCOP Domain Sequences for d1tztb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tztb_ a.79.1.1 (B:) Antitermination factor NusB {Thermotoga maritima}
ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
fvngildriakehapkekfel

SCOP Domain Coordinates for d1tztb_:

Click to download the PDB-style file with coordinates for d1tztb_.
(The format of our PDB-style files is described here.)

Timeline for d1tztb_: