![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
![]() | Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) ![]() some topological similarity to osmotin |
![]() | Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins) Pfam PF06369 |
![]() | Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species) |
![]() | Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (3 PDB entries) Uniprot P61914 40-214 |
![]() | Domain d1tzqa_: 1tzq A: [107522] mutant |
PDB Entry: 1tzq (more details), 2.3 Å
SCOPe Domain Sequences for d1tzqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzqa_ b.97.1.1 (A:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina) [TaxId: 6106]} agacidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk vphgcallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska
Timeline for d1tzqa_: