Lineage for d1tzqa_ (1tzq A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471963Fold b.97: Anemone pore-forming cytolysin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 471964Superfamily b.97.1: Anemone pore-forming cytolysin [63724] (1 family) (S)
    some topological similarity to osmotin
  5. 471965Family b.97.1.1: Anemone pore-forming cytolysin [63725] (2 proteins)
  6. 471966Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species)
  7. 471967Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (3 PDB entries)
  8. 471970Domain d1tzqa_: 1tzq A: [107522]

Details for d1tzqa_

PDB Entry: 1tzq (more details), 2.3 Å

PDB Description: crystal structure of the equinatoxin ii 8-69 double cysteine mutant

SCOP Domain Sequences for d1tzqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzqa_ b.97.1.1 (A:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina)}
agacidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk
vphgcallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg
krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska

SCOP Domain Coordinates for d1tzqa_:

Click to download the PDB-style file with coordinates for d1tzqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tzqa_: