Lineage for d1tzpb_ (1tzp B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505821Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 505822Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (4 families) (S)
    zinc-binding motif
  5. 505831Family d.65.1.3: MepA-like [111019] (1 protein)
  6. 505832Protein D-alanyl-D-alanine-endopeptidase MepA [111020] (1 species)
  7. 505833Species Escherichia coli [TaxId:562] [111021] (2 PDB entries)
  8. 505835Domain d1tzpb_: 1tzp B: [107521]

Details for d1tzpb_

PDB Entry: 1tzp (more details), 1.4 Å

PDB Description: MEPA, inactive form without ZN in P21

SCOP Domain Sequences for d1tzpb_:

Sequence, based on SEQRES records: (download)

>d1tzpb_ d.65.1.3 (B:) D-alanyl-D-alanine-endopeptidase MepA {Escherichia coli}
wqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiqrls
sqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpqald
lvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrkvrp
wfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktppplp
pscqalldeh

Sequence, based on observed residues (ATOM records): (download)

>d1tzpb_ d.65.1.3 (B:) D-alanyl-D-alanine-endopeptidase MepA {Escherichia coli}
wqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiqrls
sqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpqald
lvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrkvrp
wfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldeh

SCOP Domain Coordinates for d1tzpb_:

Click to download the PDB-style file with coordinates for d1tzpb_.
(The format of our PDB-style files is described here.)

Timeline for d1tzpb_:

Domains from other chains:
(mouse over for more information)
d1tzpa_