Lineage for d1tzof_ (1tzo F:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519489Fold f.11: Anthrax protective antigen [56987] (1 superfamily)
    4 domains; I (res. 14-225) and II (226-487) are beta-sandwiches of similar gamma-crystallin like topologies; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold
  4. 519490Superfamily f.11.1: Anthrax protective antigen [56988] (1 family) (S)
  5. 519491Family f.11.1.1: Anthrax protective antigen [56989] (1 protein)
  6. 519492Protein Anthrax protective antigen [56990] (1 species)
  7. 519493Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [56991] (3 PDB entries)
  8. 519501Domain d1tzof_: 1tzo F: [107511]

Details for d1tzof_

PDB Entry: 1tzo (more details), 3.6 Å

PDB Description: Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore

SCOP Domain Sequences for d1tzof_:

Sequence, based on SEQRES records: (download)

>d1tzof_ f.11.1.1 (F:) Anthrax protective antigen {Anthrax bacillus (Bacillus anthracis)}
tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
gdtstngikkilifskkgyeig

Sequence, based on observed residues (ATOM records): (download)

>d1tzof_ f.11.1.1 (F:) Anthrax protective antigen {Anthrax bacillus (Bacillus anthracis)}
tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
kilifskkgyeig

SCOP Domain Coordinates for d1tzof_:

Click to download the PDB-style file with coordinates for d1tzof_.
(The format of our PDB-style files is described here.)

Timeline for d1tzof_: