SCOPe 2.04: Domain d1tziv_: 1tzi V:

Lineage for d1tziv_ (1tzi V:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
   Uniprot P15692 40-133

8. Domain d1tziv_: 1tzi V: [107491]
   Other proteins in same PDB: d1tzia1, d1tzia2, d1tzib1, d1tzib2

Details for d1tziv_

PDB Entry: 1tzi, 2.8 Å

PDB Description: Crystal Structure of the Fab YADS2 Complexed with h-VEGF

PDB Compounds: (V:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d1tziv_:

Sequence; same for both SEQRES and ATOM records:

>d1tziv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkkd

Timeline for d1tziv_:

• d1tziv_ first appeared in SCOP 1.69
  
• d1tziv_ appears in SCOPe 2.03
  
• d1tziv_ appears in SCOPe 2.05
  
• d1tziv_ appears in the current release, SCOPe 2.08