Lineage for d1tziv_ (1tzi V:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461751Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1461752Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1461753Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1461765Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1461768Species Human (Homo sapiens) [TaxId:9606] [57506] (17 PDB entries)
    Uniprot P15692 40-133
  8. 1461793Domain d1tziv_: 1tzi V: [107491]
    Other proteins in same PDB: d1tzia1, d1tzia2, d1tzib1, d1tzib2

Details for d1tziv_

PDB Entry: 1tzi (more details), 2.8 Å

PDB Description: Crystal Structure of the Fab YADS2 Complexed with h-VEGF
PDB Compounds: (V:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d1tziv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tziv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkkd

SCOPe Domain Coordinates for d1tziv_:

Click to download the PDB-style file with coordinates for d1tziv_.
(The format of our PDB-style files is described here.)

Timeline for d1tziv_: