Lineage for d1tziv_ (1tzi V:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623356Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 623357Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 623358Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 623370Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 623373Species Human (Homo sapiens) [TaxId:9606] [57506] (13 PDB entries)
  8. 623396Domain d1tziv_: 1tzi V: [107491]
    Other proteins in same PDB: d1tzia1, d1tzia2, d1tzib1, d1tzib2

Details for d1tziv_

PDB Entry: 1tzi (more details), 2.8 Å

PDB Description: Crystal Structure of the Fab YADS2 Complexed with h-VEGF

SCOP Domain Sequences for d1tziv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tziv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkkd

SCOP Domain Coordinates for d1tziv_:

Click to download the PDB-style file with coordinates for d1tziv_.
(The format of our PDB-style files is described here.)

Timeline for d1tziv_: