SCOPe 2.02: Domain d1tzia2: 1tzi A:108-211

Lineage for d1tzia2 (1tzi A:108-211)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (134 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1tzia2: 1tzi A:108-211 [107488]
   Other proteins in same PDB: d1tzia1, d1tzib1, d1tzib2, d1tziv_

Details for d1tzia2

PDB Entry: 1tzi, 2.8 Å

PDB Description: Crystal Structure of the Fab YADS2 Complexed with h-VEGF

PDB Compounds: (A:) Fab YADS2 Light Chain

SCOPe Domain Sequences for d1tzia2:

Sequence; same for both SEQRES and ATOM records:

>d1tzia2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1tzia2:

• d1tzia2 first appeared in SCOP 1.69
  
• d1tzia2 appears in SCOPe 2.01
  
• d1tzia2 appears in SCOPe 2.03
  
• d1tzia2 appears in the current release, SCOPe 2.08