Lineage for d1tzia1 (1tzi A:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2022563Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022564Species Engineered (including hybrid species) [88533] (61 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2022627Domain d1tzia1: 1tzi A:1-107 [107487]
    Other proteins in same PDB: d1tzia2, d1tzib1, d1tzib2, d1tziv_

Details for d1tzia1

PDB Entry: 1tzi (more details), 2.8 Å

PDB Description: Crystal Structure of the Fab YADS2 Complexed with h-VEGF
PDB Compounds: (A:) Fab YADS2 Light Chain

SCOPe Domain Sequences for d1tzia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqsyayavawyqqkpgkapklliydasylysgvps
rfsgsgsgtdftltisslqpedfatyycqqaysspdtfgqgtkveik

SCOPe Domain Coordinates for d1tzia1:

Click to download the PDB-style file with coordinates for d1tzia1.
(The format of our PDB-style files is described here.)

Timeline for d1tzia1: