Lineage for d1tzfa_ (1tzf A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491356Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 491357Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 491595Family c.68.1.13: Cytidylytransferase [68901] (5 proteins)
  6. 491663Protein Glucose-1-phosphate cytidylyltransferase RfbF [110689] (1 species)
  7. 491664Species Salmonella typhimurium [TaxId:90371] [110690] (1 PDB entry)
  8. 491665Domain d1tzfa_: 1tzf A: [107476]

Details for d1tzfa_

PDB Entry: 1tzf (more details), 2.1 Å

PDB Description: X-ray Crystal Structure of alpha-D-glucose-1-phosphate cytidylyltransferase from Salmonella typhi

SCOP Domain Sequences for d1tzfa_:

Sequence, based on SEQRES records: (download)

>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium}
maskavilagglgtrlseetivkpkpmveiggkpilwhimkmysvhgikdfiiccgykgy
vikeyfanyflhmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvk
ddeaflftygdgvadldikatidfhkahgkkatltatfppgrfgaldiqagqvrsfqekp
kgdgaminggffvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrd
kvyleglwekgkapwktwe

Sequence, based on observed residues (ATOM records): (download)

>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium}
maskavilagglgvkpkpmveiggkpilwhimkmysvhgikdfiiccgykgyvikeyfan
yflhmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvkddeaflft
ygdgvadldikatidfhkahgkkatltatfppgrfgaldiqagqvrsfqekpkgdgamin
ggffvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrdkvyleglw
ekgkapwktwe

SCOP Domain Coordinates for d1tzfa_:

Click to download the PDB-style file with coordinates for d1tzfa_.
(The format of our PDB-style files is described here.)

Timeline for d1tzfa_: