Lineage for d1tzfa1 (1tzf A:4-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133681Family c.68.1.13: Cytidylytransferase [68901] (7 protein domains)
  6. 2133760Protein Glucose-1-phosphate cytidylyltransferase RfbF [110689] (1 species)
  7. 2133761Species Salmonella typhimurium [TaxId:90371] [110690] (2 PDB entries)
    Uniprot P26396 2-257
  8. 2133762Domain d1tzfa1: 1tzf A:4-259 [107476]
    Other proteins in same PDB: d1tzfa2
    complexed with c5g, mg

Details for d1tzfa1

PDB Entry: 1tzf (more details), 2.1 Å

PDB Description: X-ray Crystal Structure of alpha-D-glucose-1-phosphate cytidylyltransferase from Salmonella typhi
PDB Compounds: (A:) Glucose-1-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1tzfa1:

Sequence, based on SEQRES records: (download)

>d1tzfa1 c.68.1.13 (A:4-259) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]}
kavilagglgtrlseetivkpkpmveiggkpilwhimkmysvhgikdfiiccgykgyvik
eyfanyflhmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvkdde
aflftygdgvadldikatidfhkahgkkatltatfppgrfgaldiqagqvrsfqekpkgd
gaminggffvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrdkvy
leglwekgkapwktwe

Sequence, based on observed residues (ATOM records): (download)

>d1tzfa1 c.68.1.13 (A:4-259) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]}
kavilagglgvkpkpmveiggkpilwhimkmysvhgikdfiiccgykgyvikeyfanyfl
hmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvkddeaflftygd
gvadldikatidfhkahgkkatltatfppgrfgaldiqagqvrsfqekpkgdgaminggf
fvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrdkvyleglwekg
kapwktwe

SCOPe Domain Coordinates for d1tzfa1:

Click to download the PDB-style file with coordinates for d1tzfa1.
(The format of our PDB-style files is described here.)

Timeline for d1tzfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tzfa2