SCOPe 2.06: Domain d1tzcb_: 1tzc B:

Lineage for d1tzcb_ (1tzc B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.1: double-SIS domain [53698] (5 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries)
   Uniprot Q8ZWV0

8. Domain d1tzcb_: 1tzc B: [107473]
   complexed with gol, pa5, so4

Details for d1tzcb_

PDB Entry: 1tzc, 1.45 Å

PDB Description: crystal structure of phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum in complex with 5-phosphoarabinonate

PDB Compounds: (B:) glucose-6-phosphate isomerase, conjectural

SCOPe Domain Sequences for d1tzcb_:

Sequence; same for both SEQRES and ATOM records:

>d1tzcb_ c.80.1.1 (B:) Glucose-6-phosphate isomerase, conjectural {Pyrobaculum aerophilum [TaxId: 13773]}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
q

Timeline for d1tzcb_:

• d1tzcb_ first appeared in SCOP 1.69
  
• d1tzcb_ appears in SCOPe 2.05
  
• d1tzcb_ appears in SCOPe 2.07
  
• d1tzcb_ appears in the current release, SCOPe 2.08