Lineage for d1tzcb_ (1tzc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908084Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2908099Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)
  7. 2908100Species Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries)
    Uniprot Q8ZWV0
  8. 2908106Domain d1tzcb_: 1tzc B: [107473]
    complexed with gol, pa5, so4

Details for d1tzcb_

PDB Entry: 1tzc (more details), 1.45 Å

PDB Description: crystal structure of phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum in complex with 5-phosphoarabinonate
PDB Compounds: (B:) glucose-6-phosphate isomerase, conjectural

SCOPe Domain Sequences for d1tzcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzcb_ c.80.1.1 (B:) Glucose-6-phosphate isomerase, conjectural {Pyrobaculum aerophilum [TaxId: 13773]}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
q

SCOPe Domain Coordinates for d1tzcb_:

Click to download the PDB-style file with coordinates for d1tzcb_.
(The format of our PDB-style files is described here.)

Timeline for d1tzcb_: