SCOP 1.69: Domain d1tzca_: 1tzc A:

Lineage for d1tzca_ (1tzc A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (3 families)

5. Family c.80.1.1: double-SIS domain [53698] (3 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [110727] (2 PDB entries)

8. Domain d1tzca_: 1tzc A: [107472]

Details for d1tzca_

PDB Entry: 1tzc, 1.45 Å

PDB Description: crystal structure of phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum in complex with 5-phosphoarabinonate

SCOP Domain Sequences for d1tzca_:

Sequence; same for both SEQRES and ATOM records:

>d1tzca_ c.80.1.1 (A:) Glucose-6-phosphate isomerase, conjectural {Archaeon Pyrobaculum aerophilum}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
q

Timeline for d1tzca_:

• d1tzca_ is new in SCOP 1.69
  
• d1tzca_ appears in SCOP 1.71
  
• d1tzca_ appears in the current release, SCOPe 2.08