SCOPe 2.08: Domain d1tzbb_: 1tzb B:

Lineage for d1tzbb_ (1tzb B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.1: double-SIS domain [53698] (5 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries)
   Uniprot Q8ZWV0

8. Domain d1tzbb_: 1tzb B: [107471]
   complexed with gol, so4

Details for d1tzbb_

PDB Entry: 1tzb, 1.16 Å

PDB Description: crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum

PDB Compounds: (B:) glucose-6-phosphate isomerase, conjectural

SCOPe Domain Sequences for d1tzbb_:

Sequence; same for both SEQRES and ATOM records:

>d1tzbb_ c.80.1.1 (B:) Glucose-6-phosphate isomerase, conjectural {Pyrobaculum aerophilum [TaxId: 13773]}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl

Timeline for d1tzbb_:

• d1tzbb_ first appeared in SCOP 1.69
  
• d1tzbb_ appears in SCOPe 2.07