Lineage for d1tzba_ (1tzb A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875148Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1875149Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1875150Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 1875162Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)
  7. 1875163Species Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries)
    Uniprot Q8ZWV0
  8. 1875166Domain d1tzba_: 1tzb A: [107470]
    complexed with gol, so4

Details for d1tzba_

PDB Entry: 1tzb (more details), 1.16 Å

PDB Description: crystal structure of native phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum
PDB Compounds: (A:) glucose-6-phosphate isomerase, conjectural

SCOPe Domain Sequences for d1tzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzba_ c.80.1.1 (A:) Glucose-6-phosphate isomerase, conjectural {Pyrobaculum aerophilum [TaxId: 13773]}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
q

SCOPe Domain Coordinates for d1tzba_:

Click to download the PDB-style file with coordinates for d1tzba_.
(The format of our PDB-style files is described here.)

Timeline for d1tzba_: