Lineage for d1tzab_ (1tza B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 552548Superfamily b.1.23: ApaG-like [110069] (1 family) (S)
  5. 552549Family b.1.23.1: ApaG-like [110070] (1 protein)
    Pfam 04379; dimeric in crystals; this dimer is a probable biological unit
  6. 552550Protein ApaG [110071] (3 species)
  7. 552556Species Shewanella oneidensis [TaxId:70863] [110072] (1 PDB entry)
  8. 552558Domain d1tzab_: 1tza B: [107469]
    Structural genomics target
    complexed with cac

Details for d1tzab_

PDB Entry: 1tza (more details), 2.4 Å

PDB Description: X-ray structure of Northeast Structural Genomics Consortium target SoR45

SCOP Domain Sequences for d1tzab_:

Sequence, based on SEQRES records: (download)

>d1tzab_ b.1.23.1 (B:) ApaG {Shewanella oneidensis}
aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse
vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp
gllhlehhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d1tzab_ b.1.23.1 (B:) ApaG {Shewanella oneidensis}
aldnsirvevkteyieqqssekylfsytitiinlgeqaakletrhwiitdangktsevqg
agvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatpgll
hlehhhhhh

SCOP Domain Coordinates for d1tzab_:

Click to download the PDB-style file with coordinates for d1tzab_.
(The format of our PDB-style files is described here.)

Timeline for d1tzab_: