SCOP 1.71: Domain d1tzab_: 1tza B:

Lineage for d1tzab_ (1tza B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.23: ApaG-like [110069] (1 family)

5. Family b.1.23.1: ApaG-like [110070] (1 protein)
   Pfam 04379; dimeric in crystals; this dimer is a probable biological unit

6. Protein ApaG [110071] (3 species)

7. Species Shewanella oneidensis [TaxId:70863] [110072] (1 PDB entry)

8. Domain d1tzab_: 1tza B: [107469]
   Structural genomics target
   complexed with cac

Details for d1tzab_

PDB Entry: 1tza, 2.4 Å

PDB Description: X-ray structure of Northeast Structural Genomics Consortium target SoR45

SCOP Domain Sequences for d1tzab_:

Sequence, based on SEQRES records:

>d1tzab_ b.1.23.1 (B:) ApaG {Shewanella oneidensis}
aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse
vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp
gllhlehhhhhh

Sequence, based on observed residues (ATOM records):

>d1tzab_ b.1.23.1 (B:) ApaG {Shewanella oneidensis}
aldnsirvevkteyieqqssekylfsytitiinlgeqaakletrhwiitdangktsevqg
agvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatpgll
hlehhhhhh

Timeline for d1tzab_:

• d1tzab_ first appeared in SCOP 1.69
  
• d1tzab_ appears in SCOP 1.73
  
• d1tzab_ appears in the current release, SCOPe 2.08, called d1tzab1