Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.23: ApaG-like [110069] (2 families) |
Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit |
Protein ApaG [110071] (4 species) |
Species Shewanella oneidensis [TaxId:70863] [110072] (1 PDB entry) Uniprot Q8EB92 |
Domain d1tzaa1: 1tza A:3-128 [107468] Other proteins in same PDB: d1tzaa2, d1tzab2 Structural genomics target complexed with cac |
PDB Entry: 1tza (more details), 2.4 Å
SCOPe Domain Sequences for d1tzaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzaa1 b.1.23.1 (A:3-128) ApaG {Shewanella oneidensis [TaxId: 70863]} aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp gllhle
Timeline for d1tzaa1: