SCOP 1.69: Domain d1tzaa_: 1tza A:

Lineage for d1tzaa_ (1tza A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.23: ApaG-like (Pfam 04379) [110069] (1 family)

5. Family b.1.23.1: ApaG-like (Pfam 04379) [110070] (1 protein)
   dimeric in crystals; this dimer is a probable biological unit

6. Protein ApaG [110071] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [110072] (1 PDB entry)

8. Domain d1tzaa_: 1tza A: [107468]

Details for d1tzaa_

PDB Entry: 1tza, 2.4 Å

PDB Description: X-ray structure of Northeast Structural Genomics Consortium target SoR45

SCOP Domain Sequences for d1tzaa_:

Sequence; same for both SEQRES and ATOM records:

>d1tzaa_ b.1.23.1 (A:) ApaG {Shewanella oneidensis}
aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse
vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp
gllhlehhhhhh

Timeline for d1tzaa_:

• d1tzaa_ is new in SCOP 1.69
  
• d1tzaa_ appears in SCOP 1.71
  
• d1tzaa_ appears in the current release, SCOPe 2.08, called d1tzaa1