Lineage for d1tz9b_ (1tz9 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476306Superfamily c.1.15: Xylose isomerase-like [51658] (6 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 476500Family c.1.15.6: UxuA-like (Pfam 03786) [110377] (1 protein)
  6. 476501Protein Mannonate dehydratase UxuA [110378] (1 species)
  7. 476502Species Enterococcus faecalis (Streptococcus faecalis) [TaxId:1351] [110379] (1 PDB entry)
  8. 476504Domain d1tz9b_: 1tz9 B: [107467]
    Structural genomics target

Details for d1tz9b_

PDB Entry: 1tz9 (more details), 2.9 Å

PDB Description: crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41

SCOP Domain Sequences for d1tz9b_:

Sequence, based on SEQRES records: (download)

>d1tz9b_ c.1.15.6 (B:) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis)}
mkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqegla
llgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlaye
nedgslsllfdqavvenmqpedmyqlihsqskgfrlpgweeerlqqfqelkamyagvtee
dlvenlryflervipvceeenikmgihpddppweifglpritknladlkrilslvdspan
gitfctgslgadptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmae
lmqalvdvgyegvirpdhgraiwdekampgyglydramgltyiqglyeatkak

Sequence, based on observed residues (ATOM records): (download)

>d1tz9b_ c.1.15.6 (B:) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis)}
mkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqegla
llgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlaye
nedgslsllfdqavvenmqpedmyqlihsweeerlqqfqelkamyagvteedlvenlryf
lervipvceeenikmgihpddppweifglpritknladlkrilslvdspangitfctgsl
gadptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmaelmqalvdvg
yegvirpdhgraiwdekampgyglydramgltyiqglyeatkak

SCOP Domain Coordinates for d1tz9b_:

Click to download the PDB-style file with coordinates for d1tz9b_.
(The format of our PDB-style files is described here.)

Timeline for d1tz9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tz9a_