Lineage for d1tz9b1 (1tz9 B:2-353)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2089131Family c.1.15.6: UxuA-like [110377] (1 protein)
    Pfam PF03786
  6. 2089132Protein Mannonate dehydratase UxuA [110378] (1 species)
  7. 2089133Species Enterococcus faecalis (Streptococcus faecalis) [TaxId:1351] [110379] (1 PDB entry)
    Uniprot Q82ZC9
  8. 2089135Domain d1tz9b1: 1tz9 B:2-353 [107467]
    Other proteins in same PDB: d1tz9a2, d1tz9b2
    Structural genomics target

Details for d1tz9b1

PDB Entry: 1tz9 (more details), 2.9 Å

PDB Description: crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41
PDB Compounds: (B:) Mannonate dehydratase

SCOPe Domain Sequences for d1tz9b1:

Sequence, based on SEQRES records: (download)

>d1tz9b1 c.1.15.6 (B:2-353) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis) [TaxId: 1351]}
kwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqeglal
lgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlayen
edgslsllfdqavvenmqpedmyqlihsqskgfrlpgweeerlqqfqelkamyagvteed
lvenlryflervipvceeenikmgihpddppweifglpritknladlkrilslvdspang
itfctgslgadptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmael
mqalvdvgyegvirpdhgraiwdekampgyglydramgltyiqglyeatkak

Sequence, based on observed residues (ATOM records): (download)

>d1tz9b1 c.1.15.6 (B:2-353) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis) [TaxId: 1351]}
kwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqeglal
lgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlayen
edgslsllfdqavvenmqpedmyqlihsweeerlqqfqelkamyagvteedlvenlryfl
ervipvceeenikmgihpddppweifglpritknladlkrilslvdspangitfctgslg
adptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmaelmqalvdvgy
egvirpdhgraiwdekampgyglydramgltyiqglyeatkak

SCOPe Domain Coordinates for d1tz9b1:

Click to download the PDB-style file with coordinates for d1tz9b1.
(The format of our PDB-style files is described here.)

Timeline for d1tz9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tz9b2