SCOP 1.71: Domain d1tz0b_: 1tz0 B:

Lineage for d1tz0b_ (1tz0 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (4 proteins)
   subfamily of Pfam 03992

6. Protein Hypothetical protein BC2969 [110957] (1 species)

7. Species Bacillus cereus [TaxId:1396] [110958] (1 PDB entry)

8. Domain d1tz0b_: 1tz0 B: [107464]

Details for d1tz0b_

PDB Entry: 1tz0, 1.84 Å

PDB Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus

SCOP Domain Sequences for d1tz0b_:

Sequence, based on SEQRES records:

>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaa

Sequence, based on observed residues (ATOM records):

>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlagpdhiinvdhavyyvksskaa

Timeline for d1tz0b_:

• d1tz0b_ first appeared in SCOP 1.69
  
• d1tz0b_ appears in SCOP 1.73
  
• d1tz0b_ appears in the current release, SCOPe 2.08