SCOPe 2.07: Domain d1tz0a_: 1tz0 A:

Lineage for d1tz0a_ (1tz0 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein BC2969 [110957] (1 species)

7. Species Bacillus cereus [TaxId:1396] [110958] (1 PDB entry)
   Uniprot Q81C15

8. Domain d1tz0a_: 1tz0 A: [107463]
   Structural genomics target
   complexed with edo, fmt

Details for d1tz0a_

PDB Entry: 1tz0, 1.84 Å

PDB Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1tz0a_:

Sequence; same for both SEQRES and ATOM records:

>d1tz0a_ d.58.4.5 (A:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayq

Timeline for d1tz0a_:

• d1tz0a_ first appeared in SCOP 1.69
  
• d1tz0a_ appears in SCOPe 2.06
  
• d1tz0a_ appears in the current release, SCOPe 2.08