Lineage for d1tz0a_ (1tz0 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603552Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 603617Family d.58.4.5: PG130-like [102959] (4 proteins)
    subfamily of Pfam 03992
  6. 603618Protein Hypothetical protein BC2969 [110957] (1 species)
  7. 603619Species Bacillus cereus [TaxId:1396] [110958] (1 PDB entry)
  8. 603620Domain d1tz0a_: 1tz0 A: [107463]

Details for d1tz0a_

PDB Entry: 1tz0 (more details), 1.84 Å

PDB Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus

SCOP Domain Sequences for d1tz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tz0a_ d.58.4.5 (A:) Hypothetical protein BC2969 {Bacillus cereus}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayq

SCOP Domain Coordinates for d1tz0a_:

Click to download the PDB-style file with coordinates for d1tz0a_.
(The format of our PDB-style files is described here.)

Timeline for d1tz0a_: