Lineage for d1tyhe1 (1tyh E:2-221)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015324Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2015325Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2015483Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2015522Protein Transcriptional activator TenA [110030] (1 species)
  7. 2015523Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
    Uniprot P25052
  8. 2015537Domain d1tyhe1: 1tyh E:2-221 [107461]
    Other proteins in same PDB: d1tyha2, d1tyhb2, d1tyhd2, d1tyhe2

Details for d1tyhe1

PDB Entry: 1tyh (more details), 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis
PDB Compounds: (E:) Transcriptional activator tenA

SCOPe Domain Sequences for d1tyhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyhe1 a.132.1.3 (E:2-221) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsds

SCOPe Domain Coordinates for d1tyhe1:

Click to download the PDB-style file with coordinates for d1tyhe1.
(The format of our PDB-style files is described here.)

Timeline for d1tyhe1: